Lineage for d1u93a2 (1u93 A:108-214)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108335Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1108336Species Human (Homo sapiens) [TaxId:9606] [88569] (134 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1108437Domain d1u93a2: 1u93 A:108-214 [113225]
    Other proteins in same PDB: d1u93a1, d1u93b1, d1u93b2

Details for d1u93a2

PDB Entry: 1u93 (more details), 2.37 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide Analog EQDKW-[Dap]-S (cyclic)
PDB Compounds: (A:) antibody 2f5 (light chain)

SCOPe Domain Sequences for d1u93a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u93a2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d1u93a2:

Click to download the PDB-style file with coordinates for d1u93a2.
(The format of our PDB-style files is described here.)

Timeline for d1u93a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u93a1