Lineage for d1u92a1 (1u92 A:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782638Species Engineered (including hybrid species) [88533] (52 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831
    SQ NA # Humanized antibody
    SQ NA # humanized antibody
    SQ NA # engineered antibody
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 782671Domain d1u92a1: 1u92 A:1-107 [113220]
    Other proteins in same PDB: d1u92a2, d1u92b1, d1u92b2

Details for d1u92a1

PDB Entry: 1u92 (more details), 2.24 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide Analog E-[Dap]-DKWQS (cyclic)
PDB Compounds: (A:) antibody 2f5 (light chain)

SCOP Domain Sequences for d1u92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u92a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

SCOP Domain Coordinates for d1u92a1:

Click to download the PDB-style file with coordinates for d1u92a1.
(The format of our PDB-style files is described here.)

Timeline for d1u92a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u92a2