Lineage for d1u90b_ (1u90 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475934Protein Ras-related protein RalA [89662] (2 species)
  7. 2475935Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)
    Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322)
  8. 2475941Domain d1u90b_: 1u90 B: [113215]
    complexed with gdp, mg

Details for d1u90b_

PDB Entry: 1u90 (more details), 2 Å

PDB Description: crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
PDB Compounds: (B:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1u90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u90b_ c.37.1.8 (B:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
dkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

SCOPe Domain Coordinates for d1u90b_:

Click to download the PDB-style file with coordinates for d1u90b_.
(The format of our PDB-style files is described here.)

Timeline for d1u90b_: