Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ras-related protein RalA [89662] (2 species) |
Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries) Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322) |
Domain d1u90b_: 1u90 B: [113215] complexed with gdp, mg |
PDB Entry: 1u90 (more details), 2 Å
SCOPe Domain Sequences for d1u90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u90b_ c.37.1.8 (B:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle dkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar
Timeline for d1u90b_: