SCOPe 2.01: Domain d1u90a_: 1u90 A:

Lineage for d1u90a_ (1u90 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)
   Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322)

8. Domain d1u90a_: 1u90 A: [113214]
   complexed with gdp, mg

Details for d1u90a_

PDB Entry: 1u90, 2 Å

PDB Description: crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap

PDB Compounds: (A:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1u90a_:

Sequence; same for both SEQRES and ATOM records:

>d1u90a_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Timeline for d1u90a_:

• d1u90a_ first appeared in SCOP 1.71
  
• d1u90a_ appears in SCOP 1.75
  
• d1u90a_ appears in SCOPe 2.02
  
• d1u90a_ appears in the current release, SCOPe 2.08