Lineage for d1u90a_ (1u90 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582276Protein Ras-related protein RalA [89662] (2 species)
  7. 582277Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)
  8. 582282Domain d1u90a_: 1u90 A: [113214]

Details for d1u90a_

PDB Entry: 1u90 (more details), 2 Å

PDB Description: crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap

SCOP Domain Sequences for d1u90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u90a_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus)}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

SCOP Domain Coordinates for d1u90a_:

Click to download the PDB-style file with coordinates for d1u90a_.
(The format of our PDB-style files is described here.)

Timeline for d1u90a_: