SCOPe 2.06: Domain d1u8zb_: 1u8z B:

Lineage for d1u8zb_ (1u8z B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)
   Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322)

8. Domain d1u8zb_: 1u8z B: [113213]
   complexed with gdp, mg

Details for d1u8zb_

PDB Entry: 1u8z, 1.5 Å

PDB Description: Crystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap

PDB Compounds: (B:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1u8zb_:

Sequence, based on SEQRES records:

>d1u8zb_ c.37.1.8 (B:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
lalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtag
qedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdl
edkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Sequence, based on observed residues (ATOM records):

>d1u8zb_ c.37.1.8 (B:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
lalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtay
aairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdledkr
qvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Timeline for d1u8zb_:

• d1u8zb_ first appeared in SCOP 1.71
  
• d1u8zb_ appears in SCOPe 2.05
  
• d1u8zb_ appears in SCOPe 2.07
  
• d1u8zb_ appears in the current release, SCOPe 2.08