Lineage for d1u8za_ (1u8z A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988383Protein Ras-related protein RalA [89662] (2 species)
  7. 988384Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)
    Uniprot P63320 # 100% identical to the mouse and rat orthologs (Uniprot P63321 P63322)
  8. 988385Domain d1u8za_: 1u8z A: [113212]
    complexed with gdp, mg

Details for d1u8za_

PDB Entry: 1u8z (more details), 1.5 Å

PDB Description: Crystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap
PDB Compounds: (A:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1u8za_:

Sequence, based on SEQRES records: (download)

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Sequence, based on observed residues (ATOM records): (download)

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdled
krqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

SCOPe Domain Coordinates for d1u8za_:

Click to download the PDB-style file with coordinates for d1u8za_.
(The format of our PDB-style files is described here.)

Timeline for d1u8za_: