SCOP 1.71: Domain d1u8ya_: 1u8y A:

Lineage for d1u8ya_ (1u8y A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Cotton-top tamarin (Saguinus oedipus) [TaxId:9490] [117532] (3 PDB entries)

8. Domain d1u8ya_: 1u8y A: [113210]

Details for d1u8ya_

PDB Entry: 1u8y, 1.55 Å

PDB Description: CRystal structures of Ral-GppNHp and Ral-GDP reveal two novel binding sites that are also present in Ras and Rap

SCOP Domain Sequences for d1u8ya_:

Sequence, based on SEQRES records:

>d1u8ya_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus)}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknradqwnvnyvetsaktranvdkvffdlmreirar

Sequence, based on observed residues (ATOM records):

>d1u8ya_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus)}
slalhkvimvgsggvgksaltlqfmydefvedyepksyrkkvvldgeevqidildtagfr
sgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdledkrqvsveeakn
radqwnvnyvetsaktranvdkvffdlmreirar

Timeline for d1u8ya_:

• d1u8ya_ is new in SCOP 1.71
  
• d1u8ya_ appears in SCOP 1.73
  
• d1u8ya_ appears in the current release, SCOPe 2.08