Lineage for d1u8wf_ (1u8w F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951300Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117949] (1 PDB entry)
    Uniprot P39207
  8. 2951306Domain d1u8wf_: 1u8w F: [113209]

Details for d1u8wf_

PDB Entry: 1u8w (more details), 2.4 Å

PDB Description: Crystal structure of Arabidopsis thaliana nucleoside diphosphate kinase 1
PDB Compounds: (F:) Nucleoside Diphosphate Kinase I

SCOPe Domain Sequences for d1u8wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8wf_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
esarkeialwfpdgpvnwqssvhpwvyet

SCOPe Domain Coordinates for d1u8wf_:

Click to download the PDB-style file with coordinates for d1u8wf_.
(The format of our PDB-style files is described here.)

Timeline for d1u8wf_: