Lineage for d1u8wb_ (1u8w B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724273Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117949] (1 PDB entry)
  8. 724275Domain d1u8wb_: 1u8w B: [113205]

Details for d1u8wb_

PDB Entry: 1u8w (more details), 2.4 Å

PDB Description: Crystal structure of Arabidopsis thaliana nucleoside diphosphate kinase 1
PDB Compounds: (B:) Nucleoside Diphosphate Kinase I

SCOP Domain Sequences for d1u8wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8wb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
esarkeialwfpdgpvnwqssvhpwvyet

SCOP Domain Coordinates for d1u8wb_:

Click to download the PDB-style file with coordinates for d1u8wb_.
(The format of our PDB-style files is described here.)

Timeline for d1u8wb_: