SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1u8wb_ (1u8w B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2173865Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2174087Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117949] (1 PDB entry)
    Uniprot P39207
  8. 2174089Domain d1u8wb_: 1u8w B: [113205]

Details for d1u8wb_

PDB Entry: 1u8w (more details), 2.4 Å

PDB Description: Crystal structure of Arabidopsis thaliana nucleoside diphosphate kinase 1
PDB Compounds: (B:) Nucleoside Diphosphate Kinase I

SCOPe Domain Sequences for d1u8wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8wb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
esarkeialwfpdgpvnwqssvhpwvyet

SCOPe Domain Coordinates for d1u8wb_:

Click to download the PDB-style file with coordinates for d1u8wb_.
(The format of our PDB-style files is described here.)

Timeline for d1u8wb_: