Lineage for d1u8wa_ (1u8w A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603791Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 603792Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 603793Protein Nucleoside diphosphate kinase, NDK [54921] (13 species)
  7. 603914Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117949] (1 PDB entry)
  8. 603915Domain d1u8wa_: 1u8w A: [113204]

Details for d1u8wa_

PDB Entry: 1u8w (more details), 2.4 Å

PDB Description: Crystal structure of Arabidopsis thaliana nucleoside diphosphate kinase 1

SCOP Domain Sequences for d1u8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana)}
meqtfimikpdgvqrgligevicrfekkgftlkglklisversfaekhyedlssksffsg
lvdyivsgpvvamiwegknvvltgrkiigatnpaasepgtirgdfaidigrnvihgsdsv
esarkeialwfpdgpvnwqssvhpwvyet

SCOP Domain Coordinates for d1u8wa_:

Click to download the PDB-style file with coordinates for d1u8wa_.
(The format of our PDB-style files is described here.)

Timeline for d1u8wa_: