Lineage for d1u8vd1 (1u8v D:276-490)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536985Fold a.29: Bromodomain-like [47363] (6 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 537004Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 537005Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (7 proteins)
  6. 537006Protein 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal domain [116883] (1 species)
  7. 537007Species Clostridium aminobutyricum [TaxId:33953] [116884] (1 PDB entry)
  8. 537011Domain d1u8vd1: 1u8v D:276-490 [113202]
    Other proteins in same PDB: d1u8va2, d1u8vb2, d1u8vc2, d1u8vd2
    complexed with fad, fs4

Details for d1u8vd1

PDB Entry: 1u8v (more details), 1.6 Å

PDB Description: crystal structure of 4-hydroxybutyryl-coa dehydratase from clostridium aminobutyricum: radical catalysis involving a [4fe-4s] cluster and flavin

SCOP Domain Sequences for d1u8vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8vd1 a.29.3.1 (D:276-490) 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal domain {Clostridium aminobutyricum}
qeydfagmmverfagyhrqsyggckvgvgdvvigaaalaadyngaqkashvkdkliemth
lnetlyccgiacsaegyptaagnyqidlllanvckqnitrfpyeivrlaediagglmvtm
pseadfksetvvgrdgetigdfcnkffaaaptctteermrvlrfleniclgasavgyrte
smhgagspqaqrimiarqgninakkelakaiagik

SCOP Domain Coordinates for d1u8vd1:

Click to download the PDB-style file with coordinates for d1u8vd1.
(The format of our PDB-style files is described here.)

Timeline for d1u8vd1: