Lineage for d1u8vc2 (1u8v C:1-275)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617949Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 617950Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 617951Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (7 proteins)
  6. 617952Protein 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains [118187] (1 species)
  7. 617953Species Clostridium aminobutyricum [TaxId:33953] [118188] (1 PDB entry)
  8. 617956Domain d1u8vc2: 1u8v C:1-275 [113201]
    Other proteins in same PDB: d1u8va1, d1u8vb1, d1u8vc1, d1u8vd1

Details for d1u8vc2

PDB Entry: 1u8v (more details), 1.6 Å

PDB Description: crystal structure of 4-hydroxybutyryl-coa dehydratase from clostridium aminobutyricum: radical catalysis involving a [4fe-4s] cluster and flavin

SCOP Domain Sequences for d1u8vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8vc2 e.6.1.1 (C:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum}
mlmtaeqyieslrklntrvymfgekienwvdhpmirpsincvrmtyelaqdpqyadlmtt
ksnligktinrfanlhqstddlrkkvkmqrllgqktascfqrcvgmdafnavfsttyeid
qkygtnyhknfteylkyiqendlivdgamtdpkgdrglapsaqkdpdlflrivekredgi
vvrgakahqtgsinshehiimptiamteadkdyavsfacpsdadglfmiygrqscdtrkm
eegadidlgnkqfggqealvvfdnvfipndriflc

SCOP Domain Coordinates for d1u8vc2:

Click to download the PDB-style file with coordinates for d1u8vc2.
(The format of our PDB-style files is described here.)

Timeline for d1u8vc2: