Lineage for d1u8tb_ (1u8t B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691596Protein CheY protein [52174] (4 species)
  7. 691597Species Escherichia coli [TaxId:562] [52175] (33 PDB entries)
  8. 691600Domain d1u8tb_: 1u8t B: [113193]

Details for d1u8tb_

PDB Entry: 1u8t (more details), 1.5 Å

PDB Description: crystal structure of chey d13k y106w alone and in complex with a flim peptide
PDB Compounds: (B:) Chemotaxis protein cheY

SCOP Domain Sequences for d1u8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8tb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

SCOP Domain Coordinates for d1u8tb_:

Click to download the PDB-style file with coordinates for d1u8tb_.
(The format of our PDB-style files is described here.)

Timeline for d1u8tb_: