Lineage for d1u8tb_ (1u8t B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578576Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 578577Family c.23.1.1: CheY-related [52173] (18 proteins)
  6. 578585Protein CheY protein [52174] (4 species)
  7. 578586Species Escherichia coli [TaxId:562] [52175] (31 PDB entries)
  8. 578589Domain d1u8tb_: 1u8t B: [113193]

Details for d1u8tb_

PDB Entry: 1u8t (more details), 1.5 Å

PDB Description: crystal structure of chey d13k y106w alone and in complex with a flim peptide

SCOP Domain Sequences for d1u8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8tb_ c.23.1.1 (B:) CheY protein {Escherichia coli}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

SCOP Domain Coordinates for d1u8tb_:

Click to download the PDB-style file with coordinates for d1u8tb_.
(The format of our PDB-style files is described here.)

Timeline for d1u8tb_: