SCOPe 2.07: Domain d1u8ta_: 1u8t A:

Lineage for d1u8ta_ (1u8t A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d1u8ta_: 1u8t A: [113192]
   complexed with so4

Details for d1u8ta_

PDB Entry: 1u8t, 1.5 Å

PDB Description: crystal structure of chey d13k y106w alone and in complex with a flim peptide

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1u8ta_:

Sequence, based on SEQRES records:

>d1u8ta_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

Sequence, based on observed residues (ATOM records):

>d1u8ta_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgwvvkpftaatleekln
kifekm

Timeline for d1u8ta_:

• d1u8ta_ first appeared in SCOP 1.71
  
• d1u8ta_ appears in SCOPe 2.06
  
• d1u8ta_ appears in the current release, SCOPe 2.08