Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
Protein Iron-dependent regulator IdeR [46885] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) Uniprot Q50495 |
Domain d1u8rh1: 1u8r H:1-64 [113183] Other proteins in same PDB: d1u8ra2, d1u8ra3, d1u8rb2, d1u8rb3, d1u8rc2, d1u8rc3, d1u8rd2, d1u8rd3, d1u8rg2, d1u8rg3, d1u8rh2, d1u8rh3, d1u8ri2, d1u8ri3, d1u8rj2, d1u8rj3 protein/DNA complex; complexed with co, na |
PDB Entry: 1u8r (more details), 2.75 Å
SCOPe Domain Sequences for d1u8rh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8rh1 a.4.5.24 (H:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr hlel
Timeline for d1u8rh1: