Lineage for d1u8rd1 (1u8r D:1-64)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306994Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2307030Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. 2307031Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
    Uniprot Q50495
  8. 2307045Domain d1u8rd1: 1u8r D:1-64 [113177]
    Other proteins in same PDB: d1u8ra2, d1u8ra3, d1u8rb2, d1u8rb3, d1u8rc2, d1u8rc3, d1u8rd2, d1u8rd3, d1u8rg2, d1u8rg3, d1u8rh2, d1u8rh3, d1u8ri2, d1u8ri3, d1u8rj2, d1u8rj3
    protein/DNA complex; complexed with co, na

Details for d1u8rd1

PDB Entry: 1u8r (more details), 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions
PDB Compounds: (D:) iron-dependent repressor ider

SCOPe Domain Sequences for d1u8rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8rd1 a.4.5.24 (D:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

SCOPe Domain Coordinates for d1u8rd1:

Click to download the PDB-style file with coordinates for d1u8rd1.
(The format of our PDB-style files is described here.)

Timeline for d1u8rd1: