SCOP 1.73: Domain d1u8ra2: 1u8r A:65-141

Lineage for d1u8ra2 (1u8r A:65-141)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)

8. Domain d1u8ra2: 1u8r A:65-141 [113169]
   Other proteins in same PDB: d1u8ra1, d1u8ra3, d1u8rb1, d1u8rb3, d1u8rc1, d1u8rc3, d1u8rd1, d1u8rd3, d1u8rg1, d1u8rg3, d1u8rh1, d1u8rh3, d1u8ri1, d1u8ri3, d1u8rj1, d1u8rj3

Details for d1u8ra2

PDB Entry: 1u8r, 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions

PDB Compounds: (A:) iron-dependent repressor ider

SCOP Domain Sequences for d1u8ra2:

Sequence; same for both SEQRES and ATOM records:

>d1u8ra2 a.76.1.1 (A:65-141) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgvg

Timeline for d1u8ra2:

• d1u8ra2 first appeared in SCOP 1.71
  
• d1u8ra2 appears in SCOP 1.75
  
• d1u8ra2 appears in the current release, SCOPe 2.08