Lineage for d1u8oa2 (1u8o A:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656072Domain d1u8oa2: 1u8o A:108-214 [113157]
    Other proteins in same PDB: d1u8oa1, d1u8ob1, d1u8ob2

Details for d1u8oa2

PDB Entry: 1u8o (more details), 3.02 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKHAS
PDB Compounds: (A:) antibody 2f5 (light chain)

SCOP Domain Sequences for d1u8oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8oa2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1u8oa2:

Click to download the PDB-style file with coordinates for d1u8oa2.
(The format of our PDB-style files is described here.)

Timeline for d1u8oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8oa1