Lineage for d1u8na2 (1u8n A:108-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023414Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2023500Domain d1u8na2: 1u8n A:108-214 [113153]
    Other proteins in same PDB: d1u8na1, d1u8nb1, d1u8nb2

Details for d1u8na2

PDB Entry: 1u8n (more details), 2.56 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKFAS
PDB Compounds: (A:) antibody 2f5 (light chain)

SCOPe Domain Sequences for d1u8na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8na2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d1u8na2:

Click to download the PDB-style file with coordinates for d1u8na2.
(The format of our PDB-style files is described here.)

Timeline for d1u8na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8na1