SCOPe 2.06: Domain d1u8ma2: 1u8m A:108-214

Lineage for d1u8ma2 (1u8m A:108-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1u8ma2: 1u8m A:108-214 [113149]
   Other proteins in same PDB: d1u8ma1, d1u8mb1, d1u8mb2

Details for d1u8ma2

PDB Entry: 1u8m, 2.4 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKYAS

PDB Compounds: (A:) antibody 2f5 (light chain)

SCOPe Domain Sequences for d1u8ma2:

Sequence; same for both SEQRES and ATOM records:

>d1u8ma2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

Timeline for d1u8ma2:

• d1u8ma2 first appeared in SCOP 1.71
  
• d1u8ma2 appears in SCOPe 2.05
  
• d1u8ma2 appears in SCOPe 2.07
  
• d1u8ma2 appears in the current release, SCOPe 2.08