Lineage for d1u8kb2 (1u8k B:114-215)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549075Domain d1u8kb2: 1u8k B:114-215 [113143]
    Other proteins in same PDB: d1u8ka1, d1u8ka2, d1u8kb1

Details for d1u8kb2

PDB Entry: 1u8k (more details), 2.24 Å

PDB Description: crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide leldkwasl

SCOP Domain Sequences for d1u8kb2:

Sequence, based on SEQRES records: (download)

>d1u8kb2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapcskstaggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepks

Sequence, based on observed residues (ATOM records): (download)

>d1u8kb2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapcstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtytcnvnhkpsntkvdkrvepks

SCOP Domain Coordinates for d1u8kb2:

Click to download the PDB-style file with coordinates for d1u8kb2.
(The format of our PDB-style files is described here.)

Timeline for d1u8kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8kb1