![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1u8ib2: 1u8i B:114-216 [113135] Other proteins in same PDB: d1u8ia1, d1u8ia2, d1u8ib1 |
PDB Entry: 1u8i (more details), 2 Å
SCOP Domain Sequences for d1u8ib2:
Sequence, based on SEQRES records: (download)
>d1u8ib2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} tstkgpsvfplapsskstagaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
>d1u8ib2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} tstkgpsvfplapgaaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls svvtvpssslqtytcnvnhkpsntkvdkrvepksc
Timeline for d1u8ib2: