SCOP 1.71: Domain d1u8ib1: 1u8i B:1-113

Lineage for d1u8ib1 (1u8i B:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (52 PDB entries)

8. Domain d1u8ib1: 1u8i B:1-113 [113134]
   Other proteins in same PDB: d1u8ia1, d1u8ia2, d1u8ib2

Details for d1u8ib1

PDB Entry: 1u8i, 2 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ELDKWAN

SCOP Domain Sequences for d1u8ib1:

Sequence; same for both SEQRES and ATOM records:

>d1u8ib1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Timeline for d1u8ib1:

• d1u8ib1 is new in SCOP 1.71
  
• d1u8ib1 appears in SCOP 1.73
  
• d1u8ib1 appears in the current release, SCOPe 2.08