Lineage for d1u8ha2 (1u8h A:107-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549739Domain d1u8ha2: 1u8h A:107-214 [113129]
    Other proteins in same PDB: d1u8ha1, d1u8hb1, d1u8hb2

Details for d1u8ha2

PDB Entry: 1u8h (more details), 2.1 Å

PDB Description: Crystal structure of the HIV-1 Cross Neutralizing Monoclonal Antibody 2F5 in complex with gp41 Peptide ALDKWAS

SCOP Domain Sequences for d1u8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8ha2 b.1.1.2 (A:107-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1u8ha2:

Click to download the PDB-style file with coordinates for d1u8ha2.
(The format of our PDB-style files is described here.)

Timeline for d1u8ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8ha1