| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein) |
| Protein Integrin beta EGF-like domains [69941] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries) Uniprot P05106 27-716 |
| Domain d1u8cb5: 1u8c B:1563-1605 [113124] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb6 complexed with ca, nag, ndg |
PDB Entry: 1u8c (more details), 3.1 Å
SCOPe Domain Sequences for d1u8cb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8cb5 g.3.11.6 (B:1563-1605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
rtdtcmssngllcsgrgkcecgscvciqpgsygdtcekcptcp
Timeline for d1u8cb5: