Lineage for d1u8cb5 (1u8c B:1563-1605)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240965Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1241448Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 1241449Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 1241450Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
    Uniprot P05106 27-716
  8. 1241458Domain d1u8cb5: 1u8c B:1563-1605 [113124]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8cb5

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8cb5 g.3.11.6 (B:1563-1605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
rtdtcmssngllcsgrgkcecgscvciqpgsygdtcekcptcp

SCOPe Domain Coordinates for d1u8cb5:

Click to download the PDB-style file with coordinates for d1u8cb5.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb5: