SCOPe 2.02: Domain d1u8cb4: 1u8c B:1532-1562

Lineage for d1u8cb4 (1u8c B:1532-1562)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)

6. Protein Integrin beta EGF-like domains [69941] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
   Uniprot P05106 27-716

8. Domain d1u8cb4: 1u8c B:1532-1562 [113123]
   Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb6
   complexed with ca, nag, ndg

Details for d1u8cb4

PDB Entry: 1u8c, 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb4:

Sequence; same for both SEQRES and ATOM records:

>d1u8cb4 g.3.11.6 (B:1532-1562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
kgemcsghgqcscgdclcdsdwtgyycnctt

Timeline for d1u8cb4:

• d1u8cb4 first appeared in SCOP 1.71
  
• d1u8cb4 appears in SCOPe 2.01
  
• d1u8cb4 appears in SCOPe 2.03
  
• d1u8cb4 appears in the current release, SCOPe 2.08