![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.200: Integrin beta tail domain [69686] (1 superfamily) alpha-beta-loop-beta(3); loop across free side of beta-sheet |
![]() | Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) ![]() automatically mapped to Pfam PF07965 |
![]() | Family d.200.1.1: Integrin beta tail domain [69688] (1 protein) |
![]() | Protein Integrin beta tail domain [69689] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries) Uniprot P05106 27-716 |
![]() | Domain d1u8cb3: 1u8c B:1606-1690 [113122] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb4, d1u8cb5, d1u8cb6 complexed with ca, nag, ndg |
PDB Entry: 1u8c (more details), 3.1 Å
SCOPe Domain Sequences for d1u8cb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8cb3 d.200.1.1 (B:1606-1690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]} dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv rfqyyedssgksilyvveepecpkg
Timeline for d1u8cb3: