SCOPe 2.02: Domain d1u8cb3: 1u8c B:1606-1690

Lineage for d1u8cb3 (1u8c B:1606-1690)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
   alpha-beta-loop-beta(3); loop across free side of beta-sheet

4. Superfamily d.200.1: Integrin beta tail domain [69687] (1 family)

5. Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)

6. Protein Integrin beta tail domain [69689] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries)
   Uniprot P05106 27-716

8. Domain d1u8cb3: 1u8c B:1606-1690 [113122]
   Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb4, d1u8cb5, d1u8cb6
   complexed with ca, nag, ndg

Details for d1u8cb3

PDB Entry: 1u8c, 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure

PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb3:

Sequence; same for both SEQRES and ATOM records:

>d1u8cb3 d.200.1.1 (B:1606-1690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

Timeline for d1u8cb3:

• d1u8cb3 first appeared in SCOP 1.71
  
• d1u8cb3 appears in SCOPe 2.01
  
• d1u8cb3 appears in SCOPe 2.03
  
• d1u8cb3 appears in the current release, SCOPe 2.08