Lineage for d1u8cb3 (1u8c B:1606-1690)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880066Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
    alpha-beta-loop-beta(3); loop across free side of beta-sheet
  4. 880067Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) (S)
  5. 880068Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)
  6. 880069Protein Integrin beta tail domain [69689] (1 species)
  7. 880070Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries)
    Uniprot P05106 27-716
  8. 880074Domain d1u8cb3: 1u8c B:1606-1690 [113122]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag

Details for d1u8cb3

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1u8cb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8cb3 d.200.1.1 (B:1606-1690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

SCOP Domain Coordinates for d1u8cb3:

Click to download the PDB-style file with coordinates for d1u8cb3.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb3: