Lineage for d1u8cb2 (1u8c B:1107-1354)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999157Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 999158Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 999159Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 999213Protein Integrin beta A domain [69542] (1 species)
  7. 999214Species Human (Homo sapiens) [TaxId:9606] [69543] (5 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 999221Domain d1u8cb2: 1u8c B:1107-1354 [113121]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8cb2

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8cb2 c.62.1.1 (B:1107-1354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1u8cb2:

Click to download the PDB-style file with coordinates for d1u8cb2.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb2: