| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (5 families) ![]() |
| Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
| Protein Integrin beta A domain [69542] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69543] (5 PDB entries) Uniprot P05106 27-716 Uniprot P05106 27-466 Uniprot P05106 27-716 ! Uniprot P05106 27-466 |
| Domain d1u8cb2: 1u8c B:1107-1354 [113121] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb1, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6 complexed with ca, nag |
PDB Entry: 1u8c (more details), 3.1 Å
SCOP Domain Sequences for d1u8cb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8cb2 c.62.1.1 (B:1107-1354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk
Timeline for d1u8cb2: