| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) ![]() |
| Family b.1.15.1: Integrin domains [69180] (2 proteins) |
| Protein Hybrid domain of integrin beta [69183] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries) Uniprot P05106 27-466 |
| Domain d1u8cb1: 1u8c B:1058-1106,B:1355-1434 [113120] Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6 complexed with ca, nag, ndg |
PDB Entry: 1u8c (more details), 3.1 Å
SCOPe Domain Sequences for d1u8cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8cb1 b.1.15.1 (B:1058-1106,B:1355-1434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcd
Timeline for d1u8cb1: