Lineage for d1u8cb1 (1u8c B:1058-1106,B:1355-1434)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937427Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 937428Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 937429Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 937430Species Human (Homo sapiens) [TaxId:9606] [69184] (5 PDB entries)
    Uniprot P05106 27-466
  8. 937437Domain d1u8cb1: 1u8c B:1058-1106,B:1355-1434 [113120]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8ca4, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8cb1

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1u8cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8cb1 b.1.15.1 (B:1058-1106,B:1355-1434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
vsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrdlpe
elslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgfkds
livqvtfdcd

SCOPe Domain Coordinates for d1u8cb1:

Click to download the PDB-style file with coordinates for d1u8cb1.
(The format of our PDB-style files is described here.)

Timeline for d1u8cb1: