Lineage for d1u8ca4 (1u8c A:1-438)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326994Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1327416Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 1327417Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 1327418Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 1327446Species Human (Homo sapiens), isoform V [TaxId:9606] [69321] (4 PDB entries)
    Uniprot P06756 31-986
  8. 1327450Domain d1u8ca4: 1u8c A:1-438 [113119]
    Other proteins in same PDB: d1u8ca1, d1u8ca2, d1u8ca3, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8ca4

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d1u8ca4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8ca4 b.69.8.1 (A:1-438) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform V [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOPe Domain Coordinates for d1u8ca4:

Click to download the PDB-style file with coordinates for d1u8ca4.
(The format of our PDB-style files is described here.)

Timeline for d1u8ca4: