Lineage for d1u8ca2 (1u8c A:599-737)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937427Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 937428Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 937438Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 937439Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
    Uniprot P06756 31-986
  8. 937450Domain d1u8ca2: 1u8c A:599-737 [113117]
    Other proteins in same PDB: d1u8ca4, d1u8cb1, d1u8cb2, d1u8cb3, d1u8cb4, d1u8cb5, d1u8cb6
    complexed with ca, nag, ndg

Details for d1u8ca2

PDB Entry: 1u8c (more details), 3.1 Å

PDB Description: a novel adaptation of the integrin psi domain revealed from its crystal structure
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d1u8ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8ca2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOPe Domain Coordinates for d1u8ca2:

Click to download the PDB-style file with coordinates for d1u8ca2.
(The format of our PDB-style files is described here.)

Timeline for d1u8ca2: