Lineage for d1u8aa_ (1u8a A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123904Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2123905Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2123919Species Mycobacterium tuberculosis [TaxId:1773] [75194] (11 PDB entries)
    Uniprot P95014
  8. 2123929Domain d1u8aa_: 1u8a A: [113115]
    complexed with adp, cl, skm

Details for d1u8aa_

PDB Entry: 1u8a (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d1u8aa_:

Sequence, based on SEQRES records: (download)

>d1u8aa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

Sequence, based on observed residues (ATOM records): (download)

>d1u8aa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggvrpllagp
draekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOPe Domain Coordinates for d1u8aa_:

Click to download the PDB-style file with coordinates for d1u8aa_.
(The format of our PDB-style files is described here.)

Timeline for d1u8aa_: