Lineage for d1u81a_ (1u81 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2474876Protein ADP-ribosylation factor [52614] (16 species)
  7. 2474886Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
    Uniprot P32889
  8. 2474910Domain d1u81a_: 1u81 A: [113113]
    complexed with gdp, mg

Details for d1u81a_

PDB Entry: 1u81 (more details)

PDB Description: Delta-17 Human ADP Ribosylation Factor 1 Complexed with GDP
PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1u81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u81a_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOPe Domain Coordinates for d1u81a_:

Click to download the PDB-style file with coordinates for d1u81a_.
(The format of our PDB-style files is described here.)

Timeline for d1u81a_: