![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.3: CoaB-like [102645] (2 families) ![]() combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest |
![]() | Family c.72.3.1: CoaB-like [102646] (2 proteins) Pfam PF04127 |
![]() | Protein Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) [117722] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117723] (4 PDB entries) Uniprot P24285 181-404 |
![]() | Domain d1u80c_: 1u80 C: [113112] complexed with c5p, po4 |
PDB Entry: 1u80 (more details), 2.85 Å
SCOPe Domain Sequences for d1u80c_:
Sequence, based on SEQRES records: (download)
>d1u80c_ c.72.3.1 (C:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} vndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvslpt ppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdelti kmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptqgf nsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknr
>d1u80c_ c.72.3.1 (C:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} vndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvslpt ppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekideltikmvknpd ivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptqgfnsdnnal hlfwqdgdkvlplerkellgqllldeivtrydeknr
Timeline for d1u80c_: