Lineage for d1u7za_ (1u7z A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2905091Superfamily c.72.3: CoaB-like [102645] (2 families) (S)
    combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest
  5. 2905092Family c.72.3.1: CoaB-like [102646] (3 proteins)
    Pfam PF04127
  6. 2905093Protein Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) [117722] (1 species)
  7. 2905094Species Escherichia coli [TaxId:562] [117723] (4 PDB entries)
    Uniprot P24285 181-404
  8. 2905095Domain d1u7za_: 1u7z A: [113107]
    complexed with pmt

Details for d1u7za_

PDB Entry: 1u7z (more details), 2.3 Å

PDB Description: phosphopantothenoylcysteine synthetase from e. coli, 4'- phosphopantothenoyl-cmp complex
PDB Compounds: (A:) Coenzyme A biosynthesis bifunctional protein coaBC

SCOPe Domain Sequences for d1u7za_:

Sequence, based on SEQRES records: (download)

>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]}
vndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvslpt
ppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdelti
kmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptqgf
nsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknr

Sequence, based on observed residues (ATOM records): (download)

>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]}
vndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvslpt
ppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekideltikmvknpd
ivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptqgfnsdnnal
hlfwqdgdkvlplerkellgqllldeivtrydeknr

SCOPe Domain Coordinates for d1u7za_:

Click to download the PDB-style file with coordinates for d1u7za_.
(The format of our PDB-style files is described here.)

Timeline for d1u7za_: