SCOP 1.71: Domain d1u7wc_: 1u7w C:

Lineage for d1u7wc_ (1u7w C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.3: CoaB-like [102645] (1 family)
   combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest

5. Family c.72.3.1: CoaB-like [102646] (2 proteins)
   Pfam 04127

6. Protein Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) [117722] (1 species)

7. Species Escherichia coli [TaxId:562] [117723] (4 PDB entries)

8. Domain d1u7wc_: 1u7w C: [113106]
   complexed with ctp, oc2; mutant

Details for d1u7wc_

PDB Entry: 1u7w, 2.5 Å

PDB Description: phosphopantothenoylcysteine synthetase from e. coli, ctp-complex

SCOP Domain Sequences for d1u7wc_:

Sequence, based on SEQRES records:

>d1u7wc_ c.72.3.1 (C:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli}
spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdel
tikmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptq
gfnsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknr

Sequence, based on observed residues (ATOM records):

>d1u7wc_ c.72.3.1 (C:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli}
spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapedeltikmvknpd
ivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandnalhlfwqdgdkvlp
lerkellgqllldeivtrydeknr

Timeline for d1u7wc_:

• d1u7wc_ is new in SCOP 1.71
  
• d1u7wc_ appears in SCOP 1.73
  
• d1u7wc_ appears in the current release, SCOPe 2.08