Lineage for d1u7wb_ (1u7w B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591165Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 591334Superfamily c.72.3: CoaB-like [102645] (1 family) (S)
    combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest
  5. 591335Family c.72.3.1: CoaB-like [102646] (2 proteins)
    Pfam 04127
  6. 591336Protein Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) [117722] (1 species)
  7. 591337Species Escherichia coli [TaxId:562] [117723] (4 PDB entries)
  8. 591342Domain d1u7wb_: 1u7w B: [113105]

Details for d1u7wb_

PDB Entry: 1u7w (more details), 2.5 Å

PDB Description: phosphopantothenoylcysteine synthetase from e. coli, ctp-complex

SCOP Domain Sequences for d1u7wb_:

Sequence, based on SEQRES records: (download)

>d1u7wb_ c.72.3.1 (B:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli}
spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekikkqatqgdel
tikmvknpdivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicandvsqptq
gfnsdnnalhlfwqdgdkvlplerkellgqllldeivtrydeknrr

Sequence, based on observed residues (ATOM records): (download)

>d1u7wb_ c.72.3.1 (B:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli}
spvndlkhlnimitagptrepldpvryisdhssgkmgfaiaaaaarrganvtlvsgpvsl
ptppfvkrvdvmtalemeaavnasvqqqnifigcaavadyraatvapekeltikmvknpd
ivagvaalkdhrpyvvgfaaetnnveeyarqkrirknldlicanalhlfwqdgdkvlple
rkellgqllldeivtrydeknrr

SCOP Domain Coordinates for d1u7wb_:

Click to download the PDB-style file with coordinates for d1u7wb_.
(The format of our PDB-style files is described here.)

Timeline for d1u7wb_: