Lineage for d1u7td_ (1u7t D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451173Protein Type II 3-hydroxyacyl-CoA dehydrogenase [63933] (3 species)
  7. 2451174Species Human (Homo sapiens) [TaxId:9606] [102152] (2 PDB entries)
    Uniprot Q99714
  8. 2451178Domain d1u7td_: 1u7t D: [113102]
    complexed with nad, tdt

Details for d1u7td_

PDB Entry: 1u7t (more details), 2 Å

PDB Description: crystal structure of abad/hsd10 with a bound inhibitor
PDB Compounds: (D:) 3-hydroxyacyl-CoA dehydrogenase type II

SCOPe Domain Sequences for d1u7td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7td_ c.2.1.2 (D:) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
svkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadvt
sekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgtf
nvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
apigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqaiienpfl
ngevirldgairmqp

SCOPe Domain Coordinates for d1u7td_:

Click to download the PDB-style file with coordinates for d1u7td_.
(The format of our PDB-style files is described here.)

Timeline for d1u7td_: