![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Type II 3-hydroxyacyl-CoA dehydrogenase [63933] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102152] (2 PDB entries) Uniprot Q99714 |
![]() | Domain d1u7tc_: 1u7t C: [113101] complexed with nad, tdt |
PDB Entry: 1u7t (more details), 2 Å
SCOPe Domain Sequences for d1u7tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7tc_ c.2.1.2 (C:) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} svkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvfapadvt sekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldvnlmgtf nvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl apigirvmtiapglfgtplltslpekvrnflasqvpfpsrlgdpaeyahlvqaiienpfl ngevirldgairmqp
Timeline for d1u7tc_: