SCOPe 2.06: Domain d1u7pc_: 1u7p C:

Lineage for d1u7pc_ (1u7p C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (2 proteins)
   the insertion subdomain is a 3-stranded beta-sheet different from the NIF family
   automatically mapped to Pfam PF03031
   automatically mapped to Pfam PF12689

6. Protein Magnesium-dependent phosphatase-1, Mdp1 [117510] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117511] (2 PDB entries)
   Uniprot Q9D967

8. Domain d1u7pc_: 1u7p C: [113097]
   complexed with mg, wo4

Details for d1u7pc_

PDB Entry: 1u7p, 1.9 Å

PDB Description: X-ray Crystal Structure of the Hypothetical Phosphotyrosine Phosphatase MDP-1 of the Haloacid Dehalogenase Superfamily

PDB Compounds: (C:) magnesium-dependent phosphatase-1

SCOPe Domain Sequences for d1u7pc_:

Sequence; same for both SEQRES and ATOM records:

>d1u7pc_ c.108.1.17 (C:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}
trlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqniqlypevpevlgrlqsl
gvpvaaasrtseiqganqllelfdlgkyfiqreiypgskvthferlhhktgvpfsqmvff
ddenrniidvgrlgvtcihirdgmslqtltqgletfakaqagl

Timeline for d1u7pc_:

• d1u7pc_ first appeared in SCOP 1.71
  
• d1u7pc_ appears in SCOPe 2.05
  
• d1u7pc_ appears in SCOPe 2.07
  
• d1u7pc_ appears in the current release, SCOPe 2.08