Lineage for d1u7pc_ (1u7p C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594610Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 594611Superfamily c.108.1: HAD-like [56784] (18 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 594834Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (1 protein)
    the insertion subdomain is a 3-stranded beta-sheet different from the NIF family
  6. 594835Protein Magnesium-dependent phosphatase-1, Mdp1 [117510] (1 species)
  7. 594836Species Mouse (Mus musculus) [TaxId:10090] [117511] (2 PDB entries)
  8. 594839Domain d1u7pc_: 1u7p C: [113097]

Details for d1u7pc_

PDB Entry: 1u7p (more details), 1.9 Å

PDB Description: X-ray Crystal Structure of the Hypothetical Phosphotyrosine Phosphatase MDP-1 of the Haloacid Dehalogenase Superfamily

SCOP Domain Sequences for d1u7pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7pc_ c.108.1.17 (C:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus)}
trlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqniqlypevpevlgrlqsl
gvpvaaasrtseiqganqllelfdlgkyfiqreiypgskvthferlhhktgvpfsqmvff
ddenrniidvgrlgvtcihirdgmslqtltqgletfakaqagl

SCOP Domain Coordinates for d1u7pc_:

Click to download the PDB-style file with coordinates for d1u7pc_.
(The format of our PDB-style files is described here.)

Timeline for d1u7pc_: