Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (2 proteins) the insertion subdomain is a 3-stranded beta-sheet different from the NIF family automatically mapped to Pfam PF03031 automatically mapped to Pfam PF12689 |
Protein Magnesium-dependent phosphatase-1, Mdp1 [117510] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117511] (2 PDB entries) Uniprot Q9D967 |
Domain d1u7pa_: 1u7p A: [113095] complexed with mg, wo4 |
PDB Entry: 1u7p (more details), 1.9 Å
SCOPe Domain Sequences for d1u7pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} mtrlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqniqlypevpevlgrlqs lgvpvaaasrtseiqganqllelfdlgkyfiqreiypgskvthferlhhktgvpfsqmvf fddenrniidvgrlgvtcihirdgmslqtltqgletfakaqagl
Timeline for d1u7pa_: