Lineage for d1u7oa_ (1u7o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920158Family c.108.1.17: Magnesium-dependent phosphatase-1, Mdp1 [117509] (2 proteins)
    the insertion subdomain is a 3-stranded beta-sheet different from the NIF family
    automatically mapped to Pfam PF03031
    automatically mapped to Pfam PF12689
  6. 2920159Protein Magnesium-dependent phosphatase-1, Mdp1 [117510] (1 species)
  7. 2920160Species Mouse (Mus musculus) [TaxId:10090] [117511] (2 PDB entries)
    Uniprot Q9D967
  8. 2920165Domain d1u7oa_: 1u7o A: [113094]
    complexed with act

Details for d1u7oa_

PDB Entry: 1u7o (more details), 1.9 Å

PDB Description: Magnesium Dependent Phosphatase 1 (MDP-1)
PDB Compounds: (A:) magnesium-dependent phosphatase-1

SCOPe Domain Sequences for d1u7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7oa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}
mtrlpklavfdldytlwpfwvdthvdppfhkssdgtvrdrrgqniqlypevpevlgrlqs
lgvpvaaasrtseiqganqllelfdlgkyfiqreiypgskvthferlhhktgvpfsqmvf
fddenrniidvgrlgvtcihirdgmslqtltqgletfakaqag

SCOPe Domain Coordinates for d1u7oa_:

Click to download the PDB-style file with coordinates for d1u7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1u7oa_: